Loading...
Statistics
Advertisement

The Art of Jonathan Rowan
www.jcrowan.com/

Jcrowan.com

Advertisement
Conversion Technology Metas Server
Jcrowan.com is hosted in United States / Chesterfield . Jcrowan.com uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Jcrowan.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Javascript
  • Php
  • Pingback

Advertisement

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Jcrowan.com

SSL certificate

    • name: /C=US/ST=Delaware/L=Welmington/O=SureSupport LLC/CN=*.server300.com/emailAddress=admin@suresupport.com
    • subject:
      • C: US
      • ST: Delaware
      • L: Welmington
      • O: SureSupport LLC
      • CN: *.server300.com
      • emailAddress: admin@suresupport.com
    • hash: 409ca2be
    • issuer:
      • C: IL
      • O: StartCom Ltd.
      • OU: Secure Digital Certificate Signing
      • CN: StartCom Class 2 Primary Intermediate Server CA
    • version: 2
    • serialNumber: 1842867925341412
    • validFrom: 150121141804Z
    • validTo: 170121122227Z
    • validFrom_time_t: 1421849884
    • validTo_time_t: 1485001347
    • extensions:
      • basicConstraints: CA:FALSE
      • keyUsage: Digital Signature, Key Encipherment, Key Agreement
      • extendedKeyUsage: TLS Web Client Authentication, TLS Web Server Authentication
      • subjectKeyIdentifier: 60:C2:80:87:25:F4:28:0B:9D:48:8D:A1:6A:9C:02:D8:00:F3:02:26
      • authorityKeyIdentifier: keyid:11:DB:23:45:FD:54:CC:6A:71:6F:84:8A:03:D7:BE:F7:01:2F:26:86
      • subjectAltName: DNS:*.server300.com, DNS:server300.com, DNS:mysql.admin.server300.com, DNS:mysql5.admin.server300.com
      • certificatePolicies: Policy: 2.23.140.1.2.2 Policy: 1.3.6.1.4.1.23223.1.2.3 CPS: http://www.startssl.com/policy.pdf User Notice: Organization: StartCom Certification Authority Number: 1 Explicit Text: This certificate was issued according to the Class 2 Validation requirements of the StartCom CA policy, reliance only for the intended purpose in compliance of the relying party obligations.
      • crlDistributionPoints: Full Name: URI:http://crl.startssl.com/crt2-crl.crl
      • authorityInfoAccess: OCSP - URI:http://ocsp.startssl.com/sub/class2/server/ca CA Issuers - URI:http://aia.startssl.com/certs/sub.class2.server.ca.crt
      • issuerAltName: URI:http://www.startssl.com/

Meta - Jcrowan.com

Number of occurences: 2
  • Name:
    Content: text/html; charset=UTF-8
  • Name: generator
    Content: WordPress 2.1.2

Server / Hosting

  • IP: 216.35.196.26
  • Latitude: 38.65
  • Longitude: -90.53
  • Country: United States
  • City: Chesterfield

Rname

  • ns1.server300.com
  • ns2.server300.com
  • mail.jcrowan.com

Target

  • hostmaster.jcrowan.com

HTTP Header Response

HTTP/1.1 302 Found Date: Sun, 07 Aug 2016 06:10:57 GMT Server: Apache Location: site/index.php Content-Length: 0 Content-Type: text/html X-Cache: MISS from s_mf18 X-Cache-Lookup: MISS from s_mf18:80 Via: 1.1 s_mf18 (squid/3.5.9) Connection: keep-alive HTTP/1.1 200 OK Date: Sun, 07 Aug 2016 06:10:58 GMT Server: Apache Content-Type: text/html X-Cache: MISS from s_mf18 X-Cache-Lookup: MISS from s_mf18:80 Transfer-Encoding: chunked Via: 1.1 s_mf18 (squid/3.5.9) Connection: keep-alive

DNS

host: jcrowan.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 216.35.196.26
host: jcrowan.com
  1. class: IN
  2. ttl: 25920
  3. type: NS
  4. target: ns1.server300.com
host: jcrowan.com
  1. class: IN
  2. ttl: 25920
  3. type: NS
  4. target: ns2.server300.com
host: jcrowan.com
  1. class: IN
  2. ttl: 2560
  3. type: SOA
  4. mname: ns1.server300.com
  5. rname: hostmaster.jcrowan.com
  6. serial: 1470428392
  7. refresh: 16384
  8. retry: 2048
  9. expire: 1048576
  10. minimum-ttl: 2560
host: jcrowan.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mail.jcrowan.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.crowan.com, www.jzcrowan.com, www.zcrowan.com, www.jhcrowan.com, www.hcrowan.com, www.jncrowan.com, www.ncrowan.com, www.j.crowan.com, www..crowan.com, www.jucrowan.com, www.ucrowan.com, www.jkcrowan.com, www.kcrowan.com, www.jlcrowan.com, www.lcrowan.com, www.jocrowan.com, www.ocrowan.com, www.jrowan.com, www.jcdrowan.com, www.jdrowan.com, www.jcrrowan.com, www.jrrowan.com, www.jctrowan.com, www.jtrowan.com, www.jcvrowan.com, www.jvrowan.com, www.jcfrowan.com, www.jfrowan.com, www.jcgrowan.com, www.jgrowan.com, www.jchrowan.com, www.jhrowan.com, www.jcnrowan.com, www.jnrowan.com, www.jcmrowan.com, www.jmrowan.com, www.jcjrowan.com, www.jjrowan.com, www.jcowan.com, www.jcriowan.com, www.jciowan.com, www.jcroowan.com, www.jcoowan.com, www.jcrlowan.com, www.jclowan.com, www.jcrlowan.com, www.jclowan.com, www.jcr.owan.com, www.jc.owan.com, www.jcrwan.com, www.jcrobwan.com, www.jcrbwan.com, www.jcrohwan.com, www.jcrhwan.com, www.jcrogwan.com, www.jcrgwan.com, www.jcrojwan.com, www.jcrjwan.com, www.jcromwan.com, www.jcrmwan.com, www.jcro wan.com, www.jcr wan.com, www.jcrovwan.com, www.jcrvwan.com, www.jcroan.com, www.jcrow an.com, www.jcro an.com, www.jcrowcan.com, www.jcrocan.com, www.jcrowan.com, www.jcroan.com, www.jcrowdan.com, www.jcrodan.com, www.jcrowfan.com, www.jcrofan.com, www.jcrowgan.com, www.jcrogan.com, www.jcrowban.com, www.jcroban.com, www.jcrown.com, www.jcrowaon.com, www.jcrowon.com, www.jcrowapn.com, www.jcrowpn.com, www.jcrowa9n.com, www.jcrow9n.com, www.jcrowan.com, www.jcrown.com, www.jcrowain.com, www.jcrowin.com, www.jcrowaun.com, www.jcrowun.com, www.jcrowa.com, www.jcrowann.com, www.jcrowan.com, www.jcrowanh.com, www.jcrowah.com, www.jcrowanj.com, www.jcrowaj.com, www.jcrowank.com, www.jcrowak.com, www.jcrowanl.com, www.jcrowal.com, www.jcrowan .com, www.jcrowa .com,

Other websites we recently analyzed

  1. Fotograf Anders Loberg
    fotograf Anders Loberg
    Copenhagen (Denmark) - 212.97.132.113
    Server software: LiteSpeed
    Technology: CSS, Html
    Number of meta tags: 4
  2. South Yorkshire Jobs - Dedicated to the South Yorkshire jobs market
    South Yorkshire Jobs - Job in the South Yorkshire area. If you are an employer looking to fill a vacancy, why not try South Yorkshire Jobs.
    Gloucester (United Kingdom) - 88.208.252.165
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, Javascript, Google Analytics
    Number of Javascript: 1
    Number of meta tags: 3
  3. Louis Vuitton feedback
    Louis Vuitton Malletier, commonly referred to as Louis Vuitton, or shortened to LV, is a French fashion house founded in 1854 by Louis Vuitton.
    Boardman (United States) - 54.187.81.107
    G Analytics ID: UA-68128527-3
    Server software: nginx/1.6.2
    Technology: AJAX Libraries API, CSS, Fancybox, Html, Javascript, jQuery Fancybox, Google Analytics, New Relic
    Number of Javascript: 33
    Number of meta tags: 8
  4. 8756989.com
    Ottawa (Canada) - 47.90.14.232
    Server software: Microsoft-IIS/7.5
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  5. wollin.de
    Germany - 193.159.169.220
    Server software: Apache/2.2.8 (Ubuntu) mod_auth_tkt/2.0.0rc3 PHP/4.4.9 proxy_html/3.0.0 mod_ssl/2.2.8 OpenSSL/0.9.8g
    Technology: CSS, Html, Javascript, Php
    Number of meta tags: 1
  6. -秦皇岛天泽环保科技有限公司
    Mong Kok (Hong Kong) - 103.20.193.3
    Server software: IIS
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 8
    Number of meta tags: 3
  7. נטו זכוכית
    הבית שלכם עומד ועכשיו רק נשארו הפינישים "הקטנים" . חשבתם שכמעט סיימתם אבל עכשיו אתם מבינים שלמעשה אתם רק מתחילים. על מנת להשיג את הבית המושלם, אתם זקוקים לבעל מקצוע אשר ייתן את תשומת ליבו המלאה לכל פרט ופרט באורח חייכם.. אתם זקוקים לבעל מקצוע שמבין אסטטיקה ובעיקר אתם זקוקים לבעל מקצוע שאתם יכולים לסמוך עליו.
    Israel - 95.183.6.50
    Server software: Powered by STG
    Technology: CSS, Html, Javascript, Facebook Box
    Number of Javascript: 1
    Number of meta tags: 3
  8. INDUSO-Individuelle Softwarelösungen
    Individuelle Softwarelösungen
    Höst (Germany) - 176.28.50.227
    G Analytics ID: UA-67275615-1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Google Font API, Html, Html5, Javascript, Google Analytics
    Number of Javascript: 7
    Number of meta tags: 5
  9. milletvekiliadaylarihakkinda.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
    Cyprus - 93.89.226.17
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html
  10. Simon Cleave - Artist - Cologne
    United Kingdom - 149.255.62.118
    Server software: Apache
    Technology: CSS, Html, Javascript
    Number of meta tags: 2

Check Other Websites